SKU: C J C-1 295 Without D A C 10
$78.99
0 Reviews
CJC-1295 Without DAC 10mg
Product Overview CJC-1295 Without DAC is a synthetic peptide analog of growth hormone-releasing hormone (GHRH), designed for advanced laboratory and in vitro research applications. This formulation, supplied in a 10mg vial, excludes the Drug Affinity Complex (DAC) component, resulting in a shorter half-life compared to DAC-extended variants. It is widely studied in research settings for its potential to stimulate pulsatile growth hormone (GH) release from the pituitary gland, making it a valuable tool for investigating endocrine pathways, cellular signaling, and hormonal modulation.
Key Features
- Purity and Quality: Manufactured to ≥99% purity standards using HPLC purification, ensuring high integrity for reliable experimental outcomes. Lyophilized powder form for optimal stability and reconstitution.
- Molecular Profile: Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMQRDRESNQGGTNS; Molecular Weight: 3,367 Da. Non-DAC structure promotes rapid clearance, ideal for short-term dosing studies.
- Research Applications:
- Exploration of GH/IGF-1 axis dynamics in cellular models.
- Investigation of metabolic and anabolic signaling cascades.
- Comparative studies on peptide half-life and bioavailability.
Description
Intended Use This product is strictly for research purposes only. It is not intended for human or animal consumption, diagnostic procedures, or therapeutic use. All handling should comply with biosafety protocols in a controlled laboratory environment. Not for sale to non-qualified researchers.
Storage Recommendations
- Store lyophilized at -20°C for long-term stability (up to 24 months).
- After reconstitution (e.g., with bacteriostatic water), refrigerate at 2-8°C and use within 4 weeks. Avoid repeated freeze-thaw cycles.
related products
-
Quick View -
Quick View -
Quick View -
Quick View